PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 497aa    MW: 55035.9 Da    PI: 5.8173
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28110genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.31.3e-4831521128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk........................kvkaeekewyfFskrdkkyatgkrknra 77 
               lppGf FhP+d elv +yLkkk+ g+k+e  ++i+evdiyk+ePwdLp                         +v +++++w+fF+ rd+ky++g r+nra
  EMT28110   3 LPPGFGFHPKDTELVAHYLKKKILGQKIEY-DIIPEVDIYKHEPWDLPDficrvlqilivpnplmilhvtakcNVPTQDNKWHFFAARDRKYPNGARSNRA 102
               79****************************.99***************5599*************999888776666999********************* PP

       NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
               t +gyWk+tgkd+++++ +++++g+kktLvf++gr p+g++t+W+mhey +
  EMT28110 103 TVAGYWKSTGKDRAIKV-DKRTIGTKKTLVFHEGRPPTGKRTEWIMHEYYI 152
               *****************.999****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-522174IPR003441NAC domain
PROSITE profilePS5100551.9153175IPR003441NAC domain
PfamPF023652.5E-244151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MALPPGFGFH PKDTELVAHY LKKKILGQKI EYDIIPEVDI YKHEPWDLPD FICRVLQILI  60
VPNPLMILHV TAKCNVPTQD NKWHFFAARD RKYPNGARSN RATVAGYWKS TGKDRAIKVD  120
KRTIGTKKTL VFHEGRPPTG KRTEWIMHEY YIDENECQAC PDMKDAFVLC KVTKRIDWTS  180
ENGNEVGNNN PQPQQANVAA ILAVSVEQPD TAASSIIGDE LPSDAATVDI PAHTTPDGND  240
DLKEWLEELL DTSFDPSANT AVDSVSAQLS PDEQNAESSN IGAMAPKVEL DYASPNQTVV  300
DDTDFLLPDD IHSMLYPGSD DFTSWQQTYF TAADPFSLSN NFMDEFQMKE LQLPLENNGP  360
NLYEPADTGI VVRTRHGGTS AASVPPYKAR LQQSLGRMVT SSSESINQTI KFVDNNGHLD  420
LMTNVKHQKK HVRDIASARQ SDAEKCGSHN NQGFLRGVQR AFRGCSATGL NILVALCMVG  480
VAAAILHHGR HRGGISL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-40117813172Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0017230.0GU001723.1 Triticum aestivum cultivar Suwon11 NAC-domain transcription factor (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566632.10.0PREDICTED: NAC domain-containing protein 74-like
SwissprotQ7GCL70.0NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLM8BSX60.0M8BSX6_AEGTA; NAC domain-containing protein 74
STRINGMLOC_6066.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.12e-61NAC domain containing protein 86